PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc04_g16620
Common NameGSCOC_T00035769001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family ZF-HD
Protein Properties Length: 91aa    MW: 9602.72 Da    PI: 8.6203
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc04_g16620genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer106.71.4e-332480360
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                 +vrY eC+kNhAaslGg+avDGC+Efm+s geegt+ al+CaACgCHRnFHR+eve++
  Cc04_g16620 24 TVRYAECQKNHAASLGGYAVDGCREFMAS-GEEGTSGALTCAACGCHRNFHRKEVESS 80
                 79**************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-22175IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.3E-312577IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.7E-282677IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.1882776IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MKKRQIVVRK EGSRRCSSGS AVRTVRYAEC QKNHAASLGG YAVDGCREFM ASGEEGTSGA  60
LTCAACGCHR NFHRKEVESS VAEAVSESSS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591850.17e-42PREDICTED: mini zinc finger protein 1-like
RefseqXP_016511425.17e-42PREDICTED: mini zinc finger protein 1-like
RefseqXP_010037168.18e-42PREDICTED: mini zinc finger protein 3-like
SwissprotQ9LJW52e-33MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A068UUU82e-58A0A068UUU8_COFCA; Uncharacterized protein
STRINGPOPTR_0004s12510.19e-36(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-31mini zinc finger 2